PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AL_8B3A3CC2F.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 729aa    MW: 82101.5 Da    PI: 6.4632
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AL_8B3A3CC2F.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR172.11.2e-22107193290
                   FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                             Y++Y++++GFsvrk k+++ + +++i ++++ Cskeg +e ek +  +e+ + ++trt+C+a+++ + +++g+w+v++l+++HnH+l
  Traes_4AL_8B3A3CC2F.2 107 LYCDYGHRTGFSVRKGKQSYFTGTKRIRTKDYFCSKEGLKEAEKLT--DENFNDPHTRTNCRAMVRFRANSQGEWRVIRLVSDHNHNL 192
                            7*****************************************9988..9999***********************************9 PP

                   FAR1  90 a 90 
                            +
  Traes_4AL_8B3A3CC2F.2 193 V 193
                            7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.6E-20107193IPR004330FAR1 DNA binding domain
PfamPF105512.8E-28317411IPR018289MULE transposase domain
PROSITE profilePS509669.606600636IPR007527Zinc finger, SWIM-type
SMARTSM005750.0036611638IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 729 aa     Download sequence    Send to blast
MVNTDGEGAD AVGGDPMCVD ESAAVVAGMG ADQCEGARLQ DSGAAVSIEG AREGEVPVSH  60
PGGGMRVRGA TVEEAENEEA PTVQGSKEGA EELLLKVVYS EEEAYKLYCD YGHRTGFSVR  120
KGKQSYFTGT KRIRTKDYFC SKEGLKEAEK LTDENFNDPH TRTNCRAMVR FRANSQGEWR  180
VIRLVSDHNH NLVRPEERHL LRSAKSLIAG RSCSAADAVL YGGYQLGGAP SQMAASTSVA  240
NNAETQRQDL LPGFSGITRT SAVGTGELQS IVSHLKSRAN VDGMFYWDVH LDRAGRMSNF  300
FWRDGRSRMD YDCFGDVVVF DSTYRLNKQN YIVAPFVGVN HHWQTTMYGC ALLADDSMAS  360
FTWLFKSFLE AMGNRQPRSI FTNQDQVMSN AIEEVFPNTC HRIAHWHIQK NAASRLGALN  420
ASKAFNKMFT KCMQGCDSEA EFEGTWAAML REFKLQDNKW LSKLYKLKQK WCGALNKCTF  480
DGGVENEPQC DSLSNIFTCI VDKSTSLSTM VAAVDKLTED WREKEFDEDV RCCQRPLSCI  540
IKHSDILNHA AKVYTHRIYK LFETYFLDGC GATKFKALPC EDSDTYRFEM TMQGRGSRVC  600
TVHLNMSTMQ LTCSCSQFET MGLLCPHTLK ALSIKNVGKI PEIYILKRWT RDAKQWVFNP  660
KQYESSFQEC MDDEAGYCNH AMRYAYDLVM KSEGQEELRR SLWQALESGE KELEKYLENA  720
TQYPQSYAT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010236809.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 7-like
RefseqXP_014756443.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 7-like
RefseqXP_014756444.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 7-like
TrEMBLW5DR670.0W5DR67_WHEAT; Uncharacterized protein
STRINGMLOC_43316.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-85FAR1-related sequence 5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]